Protein Info for Rv3530c in Mycobacterium tuberculosis H37Rv

Annotation: Possible oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 199 (192 residues), 139.5 bits, E=1.5e-44
• PF08659: KR
  • amino acids 11 to 184 (174 residues), 35.2 bits, E=1.8e-12
• PF13561: adh_short_C2
  • amino acids 15 to 256 (242 residues), 180.1 bits, E=8e-57

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_3594c)

Predicted SEED Role

"2,3-dihydroxy-2,3-dihydro-phenylpropionate dehydrogenase (EC 1.3.1.-)" in subsystem Cinnamic Acid Degradation or Naphtalene and antracene degradation or Phenylpropanoid compound degradation or Phenylpropionate Degradation (EC 1.3.1.-)

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (1/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (1/5 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Alkaloid biosynthesis I
• Biosynthesis of unsaturated fatty acids
• Carotenoid biosynthesis - General
• Fatty acid biosynthesis
• Fluorene degradation
• Fluorobenzoate degradation
• Insect hormone biosynthesis
• Isoflavonoid biosynthesis
• Nucleotide sugars metabolism
• Phenylalanine metabolism
• Porphyrin and chlorophyll metabolism
• Propanoate metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• Tryptophan metabolism
• alpha-Linolenic acid metabolism
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.3.1.-

Use Curated BLAST to search for 1.-.-.- or 1.3.1.-

Protein Sequence (260 amino acids)

>Rv3530c Possible oxidoreductase (Mycobacterium tuberculosis H37Rv)
MTGMLKRKVIVVSGVGPGLGTTLAHRCARDGADLVLAARSAERLDDVAKQIIDTGRRAVA
VRTDITDDDDVSNLVQATLAAYGKADVLINNAFRVPSMKPLAGTTFEHIRDAIELSALGT
LRLIQAFTPALAQSHGAIVNVNSMVIRHSQPKYGTYKMAKSVLLAMSHSLATELGEQGIR
VNSVAPGYIWGDTLKSYFDHQAGKYGTTVDQIYQATAANSDLKRLPTEDEVASAILFLAS
DLASGITGQTLDVNCGEYHT