Protein Info for Rv3501c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved integral membrane protein YrbE4A. Possible ABC transporter.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 90 to 114 (25 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 191 to 191 (1 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details PF02405: MlaE" amino acids 36 to 247 (212 residues), 206.7 bits, see alignment E=1.6e-65

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 99% identity to mul:MUL_4064)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>Rv3501c Conserved integral membrane protein YrbE4A. Possible ABC transporter. (Mycobacterium tuberculosis H37Rv)
LIQQLAVPARAVGGFFEMSMDTARAAFRRPFQFREFLDQTWMVARVSLVPTLLVSIPFTV
LVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVVAGAGATAICADLGARTIREE
IDAMRVLGIDPIQRLVVPRVLASTLVALLLNGLVCAIGLSGGYAFSVFLQGVNPGAFING
LTVLTGLRELILAEIKALLFGVMAGLVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVI
NVVMTAIGVRISAQ