Protein Info for Rv3499c in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce4A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 30 to 32 (3 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 11 to 298 (288 residues), 271 bits, see alignment E=5.8e-85 PF02470: MlaD" amino acids 40 to 118 (79 residues), 62.1 bits, see alignment E=5e-21 PF11887: Mce4_CUP1" amino acids 122 to 340 (219 residues), 177.7 bits, see alignment E=2.7e-56

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13533)

Predicted SEED Role

"MCE-family protein Mce1A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>Rv3499c Mce-family protein Mce4A (Mycobacterium tuberculosis H37Rv)
MSGGGSRRTSVRVAAALLAGLMVGSAVLTYLSYTAAFTSTDTVTVSSPRAGLVMEKGAKV
KYRGIQVGKVTDISYSGNQARLKLAIDSGEMGFIPSNATVRIAGNTIFGAKSVEFIPPKT
PSPKPLSPNAHVAASQVQLEVNTLFQSLIDLLHKIDPLETNATLSALSEGLRGHGDDLGA
LLSGLNTLTRQANPKLPALQEDFRKAAVVANVYADAAGDLNTVFDNLPTINKTIVDQKDN
LNDTLLATIGLSNNAYETLAPAEQNFIDAINRLRAPLKVTSDYSPVFGCLFKGIARGVKE
FAPLIGVRKAGLFTSSSFVLGAPSYTYPESLPIVNASGGPNCRGLPDIPTKQTGGSFYRA
PFLVTDNALIPYQPFTELQVDAPSTLQFLFNGAFAERDDF