Protein Info for Rv3498c in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce4B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 16 to 298 (283 residues), 280.7 bits, see alignment E=6.4e-88 PF02470: MlaD" amino acids 42 to 118 (77 residues), 68.7 bits, see alignment E=4.2e-23 PF11887: Mce4_CUP1" amino acids 122 to 337 (216 residues), 188.2 bits, see alignment E=1.7e-59

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to mtf:TBFG_13532)

Predicted SEED Role

"MCE-family protein Mce1B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>Rv3498c Mce-family protein Mce4B (Mycobacterium tuberculosis H37Rv)
MAGSGVPSHRSMVIKVSVFAVVMLLVAAGLVVVFGDFRFGPTTVYHATFTDASRLKAGQK
VRIAGVPVGSVKAVKLNPDHSIDVAFAIDRSYTLYSSTRAVIRYENLVGDRFLEITSGPG
ELRKLPPGGTINVAHTQPALDLDALLGGLRPVLKGFDADKINTITSAVIELLQGQGGPLA
NVLADTGAFSAALGARDQLIGEVITNLNAVLATVDAKSAQFSASVDQLQQLVSGLAKNRD
PIAGAISPLASTTTDLTELLRNSRRPLQGILENARPLATELDNRKAEVNNDIEQLGEDYL
RLSALGSYGAFFNIYFCSVTIKINGPAGSDILLPIGGQPDPSKGRCAFAK