Protein Info for Rv3487c in Mycobacterium tuberculosis H37Rv

Annotation: Probable esterase/lipase LipF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF20434: BD-FAE" amino acids 13 to 100 (88 residues), 36.6 bits, see alignment E=5.3e-13 PF10340: Say1_Mug180" amino acids 14 to 124 (111 residues), 36.6 bits, see alignment E=3.7e-13 PF07859: Abhydrolase_3" amino acids 16 to 222 (207 residues), 154.2 bits, see alignment E=6.5e-49

Best Hits

Swiss-Prot: 100% identical to LIPF_MYCTU: Carboxylesterase LipF (lipF) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13522)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>Rv3487c Probable esterase/lipase LipF (Mycobacterium tuberculosis H37Rv)
VRAPGVRAADGAGRVVLYLHGGAFVMCGPNSHSRIVNALSGFAESPVLIVDYRLIPKHSL
GMALDDCHDAYQWLRARGYRPEQIVLAGDSAGGYLALALAQRLQCDDEKPAAIVAISPLL
QLAKGPKQDHPNIGTDAMFPARAFDALAAWVRAAAAKNMVDGRPEDLYEPLDHIESSLPP
TLIHVSGSEVLLHDAQLGAGKLAAAGVCAEVRVWPGQAHLFQLATPLVPEATRSLRQIGQ
FIRDATADSSLSPVHRSRYVAGSPRAASRGAFGQSPI