Protein Info for Rv3486 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 91 (46 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details PF07681: DoxX" amino acids 11 to 89 (79 residues), 59.8 bits, see alignment E=5.2e-20 PF13564: DoxX_2" amino acids 13 to 96 (84 residues), 26.4 bits, see alignment E=9.5e-10

Best Hits

Swiss-Prot: 100% identical to Y3486_MYCTU: Uncharacterized membrane protein Rv3486 (Rv3486) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mtb:TBMG_03532)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>Rv3486 Conserved protein (Mycobacterium tuberculosis H37Rv)
LHAEGPPSVICIRLLVGLVFLSEGIQKFMYPDQLGPGRFERIGIPAATFFADLDGVVEIV
CGTLVLLGLLTRVAAVPLLIDMVGAIVLTKLRALQPGGFLGVEGFWGMAHAARTDLSMLL
GLIFLLWSGPGRWSLDRRLSKRATACGAR