Protein Info for Rv3485c in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF23441: SDR" amino acids 45 to 290 (246 residues), 29.9 bits, see alignment E=9.4e-11 PF08659: KR" amino acids 47 to 209 (163 residues), 62.8 bits, see alignment E=1e-20 PF00106: adh_short" amino acids 48 to 239 (192 residues), 152.5 bits, see alignment E=2.7e-48 PF01370: Epimerase" amino acids 49 to 215 (167 residues), 22.9 bits, see alignment E=1.3e-08 PF13561: adh_short_C2" amino acids 55 to 287 (233 residues), 197.3 bits, see alignment E=7.8e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13520)

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>Rv3485c Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
MNSRAPRNLAVSSPSAQVTGRMVQNGENLFQFRREGPQVQLSFQDRTYLVTGGGSGIGKG
VAAGLVAAGAAVMIVGRNPDKLAAAVKDIEALKTGAIGYEPADITDEEQTLRVVDAATAW
HGRLHGVVHCAGGSQTIGPITQIDSQAWRRTVDLNVNGTMYVLKHAARELVRGGGGSFVG
ISSIAASNTHRWFGAYGVTKSAVDHMMKLAADELGPSWVRVNSIRPGLIRTDLVVPVTES
PELSADYRVCTPLPRVGEVEDVANLAMFLLSDAASWITGQVINVDGGHMLRRGPDFSPML
EPVFGADGLRGVVG