Protein Info for Rv3484 in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved protein CpsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details TIGR00350: cell envelope-related function transcriptional attenuator common domain" amino acids 109 to 280 (172 residues), 95.5 bits, see alignment E=1.9e-31 PF03816: LytR_cpsA_psr" amino acids 109 to 281 (173 residues), 137.9 bits, see alignment E=3.2e-44 PF13399: LytR_C" amino acids 379 to 464 (86 residues), 47.5 bits, see alignment E=2.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_3548)

Predicted SEED Role

"Cell envelope-associated transcriptional attenuator LytR-CpsA-Psr, subfamily A1 (as in PMID19099556)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>Rv3484 Possible conserved protein CpsA (Mycobacterium tuberculosis H37Rv)
MARSEGNRPRHRAVPQPSRIRKRLSRGVMTLVSVVALLMTGAGYWVAHGALGGITISQAL
TPEDPRSSGNNMNILLIGLDSRKDQEGNDLPWSVLKQLHAGDSDDGGYNTNTLILVHVGA
DGKVVAFSIPRDDWVPFTGVPGYNHIKIKEAYGLTKQYVAEQLANQGVSDRKELETRGRE
AARAATLRAVRSLTGVPIDYFAEINLAGFYDLAQTLGGVDVCLNHAVYDSYSGADFPAGR
QRLNAAQALAFVRQRHGLDNGDLDRTHRQQAFLSSVMRELQDSGTFTNLDRLDNLMAVAR
KDVVLSAGWDEDLFRRMGDLAGGNVEFRTLPVVRYDNIDGQDVNIIDPTAIRAEVAAAFG
SAPPTSQTAAAAKPNPSTVVDVVNAGSISGLASQVSGALLKRGYTAGQVRDRESGDPFTT
AIEYGAGAETDAQNVADLLGIDAPNHPDPAVAPGHIRVTVDTNFSLPAPDEATAAATSTE
TSTYPLYGGGTTTDPTPDQGAPIDGGGVPCVN