Protein Info for Rv3441c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phospho-sugar mutase / MrsA protein homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 133 (131 residues), 143.2 bits, E=8.9e-46
• TIGR01455: phosphoglucosamine mutase
  • amino acids 5 to 445 (441 residues), 636.7 bits, E=9.2e-196
• PF02879: PGM_PMM_II
  • amino acids 161 to 256 (96 residues), 65 bits, E=1.7e-21
• PF02880: PGM_PMM_III
  • amino acids 260 to 369 (110 residues), 104.9 bits, E=5.5e-34
• PF00408: PGM_PMM_IV
  • amino acids 376 to 444 (69 residues), 69.5 bits, E=4.1e-23

Best Hits

Swiss-Prot: 100% identical to GLMM_MYCBO: Phosphoglucosamine mutase (glmM) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to mbb:BCG_3507c)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (33/33 steps found)
• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (8/8 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• chitin biosynthesis (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• peptidoglycan recycling I (8/14 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (1/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (5/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Protein Sequence (448 amino acids)

>Rv3441c Probable phospho-sugar mutase / MrsA protein homolog (Mycobacterium tuberculosis H37Rv)
MGRLFGTDGVRGVANRELTAELALALGAAAARRLSRSGAPGRRVAVLGRDPRASGEMLEA
AVIAGLTSEGVDALRVGVLPTPAVAYLTGAYDADFGVMISASHNPMPDNGIKIFGPGGHK
LDDDTEDQIEDLVLGVSRGPGLRPAGAGIGRVIDAEDATERYLRHVAKAATARLDDLAVV
VDCAHGAASSAAPRAYRAAGARVIAINAEPNGRNINDGCGSTHLDPLRAAVLAHRADLGL
AHDGDADRCLAVDANGDLVDGDAIMVVLALAMKEAGELACNTLVATVMSNLGLHLAMRSA
GVTVRTTAVGDRYVLEELRAGDYSLGGEQSGHIVMPALGSTGDGIVTGLRLMTRMVQTGS
SLSDLASAMRTLPQVLINVEVVDKATAAAAPSVRTAVEQAAAELGDTGRILLRPSGTEPM
IRVMVEAADEGVAQRLAATVADAVSTAR