Protein Info for Rv3419c in Mycobacterium tuberculosis H37Rv

Annotation: Probable O-sialoglycoprotein endopeptidase Gcp (glycoprotease)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 261 to 277 (17 residues), see Phobius details TIGR03723: tRNA threonylcarbamoyl adenosine modification protein TsaD" amino acids 4 to 318 (315 residues), 377.1 bits, see alignment E=6.2e-117 TIGR00329: metallohydrolase, glycoprotease/Kae1 family" amino acids 5 to 312 (308 residues), 289.4 bits, see alignment E=3.1e-90 PF00814: TsaD" amino acids 29 to 312 (284 residues), 276.5 bits, see alignment E=1.4e-86

Best Hits

Swiss-Prot: 100% identical to TSAD_MYCTU: tRNA N6-adenosine threonylcarbamoyltransferase (tsaD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01409, O-sialoglycoprotein endopeptidase [EC: 3.4.24.57] (inferred from 100% identity to mtc:MT3528)

Predicted SEED Role

"TsaD/Kae1/Qri7 protein, required for threonylcarbamoyladenosine t(6)A37 formation in tRNA"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>Rv3419c Probable O-sialoglycoprotein endopeptidase Gcp (glycoprotease) (Mycobacterium tuberculosis H37Rv)
MTTVLGIETSCDETGVGIARLDPDGTVTLLADEVASSVDEHVRFGGVVPEIASRAHLEAL
GPAMRRALAAAGLKQPDIVAATIGPGLAGALLVGVAAAKAYSAAWGVPFYAVNHLGGHLA
ADVYEHGPLPECVALLVSGGHTHLLHVRSLGEPIIELGSTVDDAAGEAYDKVARLLGLGY
PGGKALDDLARTGDRDAIVFPRGMSGPADDRYAFSFSGLKTAVARYVESHAADPGFRTAD
IAAGFQEAVADVLTMKAVRAATALGVSTLLIAGGVAANSRLRELATQRCGEAGRTLRIPS
PRLCTDNGAMIAAFAAQLVAAGAPPSPLDVPSDPGLPVMQGQVR