Protein Info for Rv3414c in Mycobacterium tuberculosis H37Rv

Annotation: Probable alternative RNA polymerase sigma-D factor SigD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 43 to 204 (162 residues), 75.5 bits, see alignment E=1.9e-25 PF04542: Sigma70_r2" amino acids 50 to 119 (70 residues), 48 bits, see alignment E=1.3e-16 PF08281: Sigma70_r4_2" amino acids 152 to 201 (50 residues), 40.4 bits, see alignment E=2.7e-14 PF04545: Sigma70_r4" amino acids 154 to 202 (49 residues), 37.8 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 100% identical to RPSD_MYCTU: ECF RNA polymerase sigma factor SigD (sigD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mtb:TBMG_03465)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (212 amino acids)

>Rv3414c Probable alternative RNA polymerase sigma-D factor SigD (Mycobacterium tuberculosis H37Rv)
MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLETIRPIVVRYCR
ARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRD
RAYPAETLPERWSADAGPEQMAIEADSVTRMNELLEILPAKQREILILRVVVGLSAEETA
AAVGSTTGAVRVAQHRALQRLKDEIVAAGDYA