Protein Info for Rv3400 in Mycobacterium tuberculosis H37Rv

Annotation: Probable hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00702: Hydrolase" amino acids 23 to 225 (203 residues), 85.6 bits, see alignment E=9.2e-28 TIGR02009: beta-phosphoglucomutase family hydrolase" amino acids 23 to 232 (210 residues), 214.7 bits, see alignment E=1.3e-67 PF13419: HAD_2" amino acids 26 to 231 (206 residues), 54.2 bits, see alignment E=3.1e-18 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 133 to 232 (100 residues), 39.7 bits, see alignment E=5.7e-14 PF13242: Hydrolase_like" amino acids 188 to 261 (74 residues), 24.7 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 100% identical to Y3433_MYCBO: Uncharacterized protein Mb3433 (BQ2027_MB3433) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03451)

Predicted SEED Role

"Beta-phosphoglucomutase (EC 5.4.2.6)" in subsystem Maltose and Maltodextrin Utilization or N-Acetyl-Galactosamine and Galactosamine Utilization or Trehalose Uptake and Utilization (EC 5.4.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>Rv3400 Probable hydrolase (Mycobacterium tuberculosis H37Rv)
MANWYRPNYPEVRSRVLGLPEKVRACLFDLDGVLTDTASLHTKAWKAMFDAYLAERAERT
GEKFVPFDPAADYHTYVDGKKREDGVRSFLSSRAIEIPDGSPDDPGAAETVYGLGNRKND
MLHKLLRDDGAQVFDGSRRYLEAVTAAGLGVAVVSSSANTRDVLATTGLDRFVQQRVDGV
TLREEHIAGKPAPDSFLRAAELLGVTPDAAAVFEDALSGVAAGRAGNFAVVVGINRTGRA
AQAAQLRRHGADVVVTDLAELL