Protein Info for Rv3396c in Mycobacterium tuberculosis H37Rv

Annotation: Probable GMP synthase [glutamine-hydrolyzing] GuaA (glutamine amidotransferase) (GMP synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 17 to 201 (185 residues), 246.3 bits, see alignment E=1.5e-77 PF00117: GATase" amino acids 18 to 197 (180 residues), 146.3 bits, see alignment E=1.8e-46 PF07722: Peptidase_C26" amino acids 81 to 181 (101 residues), 32.1 bits, see alignment E=2e-11 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 211 to 525 (315 residues), 485.5 bits, see alignment E=6.7e-150 PF02540: NAD_synthase" amino acids 215 to 257 (43 residues), 24.7 bits, see alignment 2.5e-09 PF00958: GMP_synt_C" amino acids 432 to 524 (93 residues), 135.3 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 100% identical to GUAA_MYCBT: GMP synthase [glutamine-hydrolyzing] (guaA) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to mtc:MT3504)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>Rv3396c Probable GMP synthase [glutamine-hydrolyzing] GuaA (glutamine amidotransferase) (GMP synthetase) (Mycobacterium tuberculosis H37Rv)
VVQPADIDVPETPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIRARQPVA
LVLSGGPASVYADGAPKLDPALLDLGVPVLGICYGFQAMAQALGGIVAHTGTREYGRTEL
KVLGGKLHSDLPEVQPVWMSHGDAVTAAPDGFDVVASSAGAPVAAFEAFDRRLAGVQYHP
EVMHTPHGQQVLSRFLHDFAGLGAQWTPANIANALIEQVRTQIGDGHAICGLSGGVDSAV
AAALVQRAIGDRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVS
APEGKRKIIGRQFIRAFEGAVRDVLDGKTAEFLVQGTLYPDVVESGGGSGTANIKSHHNV
GGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRIVGEVTAKRL
DTLRHADSIVREELTAAGLDNQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDA
MTADWTRVPYEVLERISTRITNEVAEVNRVVLDITSKPPATIEWE