Protein Info for Rv3342 in Mycobacterium tuberculosis H37Rv

Annotation: Possible methyltransferase (methylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF13489: Methyltransf_23" amino acids 24 to 147 (124 residues), 32.8 bits, see alignment E=1.7e-11 PF01209: Ubie_methyltran" amino acids 39 to 132 (94 residues), 29.2 bits, see alignment E=1.7e-10 PF13847: Methyltransf_31" amino acids 40 to 131 (92 residues), 36.3 bits, see alignment E=1.4e-12 PF13649: Methyltransf_25" amino acids 42 to 129 (88 residues), 67.9 bits, see alignment E=3.2e-22 PF08241: Methyltransf_11" amino acids 43 to 131 (89 residues), 81.8 bits, see alignment E=1.3e-26 PF08242: Methyltransf_12" amino acids 43 to 131 (89 residues), 44.6 bits, see alignment E=6e-15

Best Hits

Swiss-Prot: 100% identical to Y3342_MYCTO: Uncharacterized methyltransferase MT3445 (MT3445) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mbb:BCG_3412)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>Rv3342 Possible methyltransferase (methylase) (Mycobacterium tuberculosis H37Rv)
VTCSRRDMSLSFGSAVGAYERGRPSYPPEAIDWLLPAAARRVLDLGAGTGKLTTRLVERG
LDVVAVDPIPEMLDVLRAALPQTVALLGTAEEIPLDDNSVDAVLVAQAWHWVDPARAIPE
VARVLRPGGRLGLVWNTRDERLGWVRELGEIIGRDGDPVRDRVTLPEPFTTVQRHQVEWT
NYLTPQALIDLVASRSYCITSPAQVRTKTLDRVRQLLATHPALANSNGLALPYVTVCVRA
TLA