Protein Info for Rv3315c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cytidine deaminase Cdd (cytidine aminohydrolase) (cytidine nucleoside deaminase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08211: dCMP_cyt_deam_2
  • amino acids 8 to 60 (53 residues), 28.1 bits, E=2.1e-10
• PF00383: dCMP_cyt_deam_1
  • amino acids 13 to 101 (89 residues), 49.4 bits, E=3.6e-17

Best Hits

Swiss-Prot: 100% identical to CDD_MYCTO: Cytidine deaminase (cdd) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to mbo:Mb3344c)

Predicted SEED Role

"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)

MetaCyc Pathways

• pyrimidine deoxyribonucleosides degradation (3/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
• pyrimidine ribonucleosides degradation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• pyrimidine ribonucleosides salvage II (1/2 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)
• pyrimidine ribonucleosides salvage I (1/3 steps found)
• pyrimidine deoxyribonucleosides salvage (2/5 steps found)
• superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.5

Protein Sequence (133 amino acids)

>Rv3315c Probable cytidine deaminase Cdd (cytidine aminohydrolase) (cytidine nucleoside deaminase) (Mycobacterium tuberculosis H37Rv)
MPDVDWNMLRGNATQAAAGAYVPYSRFAVGAAALVDDGRVVTGCNVENVSYGLTLCAECA
VVCALHSTGGGRLLALACVDGHGSVLMPCGRCRQVLLEHGGSELLIDHPVRPRRLGDLLP
DAFGLDDLPRERR