Protein Info for Rv3314c in Mycobacterium tuberculosis H37Rv

Annotation: Probable thymidine phosphorylase DeoA (tdrpase) (pyrimidine phosphorylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR02644: pyrimidine-nucleoside phosphorylase" amino acids 10 to 411 (402 residues), 533.4 bits, see alignment E=1.9e-164 PF02885: Glycos_trans_3N" amino acids 10 to 71 (62 residues), 67.5 bits, see alignment E=1.1e-22 PF00591: Glycos_transf_3" amino acids 83 to 291 (209 residues), 121.6 bits, see alignment E=6.9e-39 PF07831: PYNP_C" amino acids 339 to 411 (73 residues), 69.2 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 100% identical to TYPH_MYCTU: Thymidine phosphorylase (deoA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00758, thymidine phosphorylase [EC: 2.4.2.4] (inferred from 100% identity to mbb:BCG_3380c)

Predicted SEED Role

"Thymidine phosphorylase (EC 2.4.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 2.4.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>Rv3314c Probable thymidine phosphorylase DeoA (tdrpase) (pyrimidine phosphorylase) (Mycobacterium tuberculosis H37Rv)
VTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAIVWRGMDRGEI
ARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPLVPVVAACGGAVPQASGRGLG
HTGGTLDKLESITGFTANLSNQRVREQLCDVGAAIFAAGQLAPADAKLYALRDITGTVES
LPLIASSIMSKKLAEGAGALVLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALL
TEMNCPLGRTVGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRRLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLAAWRLGAGRSR
PGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGAARAELAGGWSIRDSPPQVRP
LIVDRIV