Protein Info for Rv3309c in Mycobacterium tuberculosis H37Rv

Annotation: Probable uracil phosphoribosyltransferase Upp (UMP pyrophosphorylase) (uprtase) (UMP diphosphorylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR01091: uracil phosphoribosyltransferase" amino acids 2 to 206 (205 residues), 259.3 bits, see alignment E=1.2e-81 PF14681: UPRTase" amino acids 5 to 205 (201 residues), 223.8 bits, see alignment E=1.7e-70 PF00156: Pribosyltran" amino acids 67 to 175 (109 residues), 37.9 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 100% identical to UPP_MYCBO: Uracil phosphoribosyltransferase (upp) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to mtc:MT3408)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.9

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>Rv3309c Probable uracil phosphoribosyltransferase Upp (UMP pyrophosphorylase) (uprtase) (UMP diphosphorylase) (Mycobacterium tuberculosis H37Rv)
VQVHVVDHPLAAARLTTLRDERTDNAGFRAALRELTLLLIYEATRDAPCEPVPIRTPLAE
TVGSRLTKPPLLVPVLRAGLGMVDEAHAALPEAHVGFVGVARDEQTHQPVPYLDSLPDDL
TDVPVMVLDPMVATGGSMTHTLGLLISRGAADITVLCVVAAPEGIAALQKAAPNVRLFTA
AIDEGLNEVAYIVPGLGDAGDRQFGPR