Protein Info for Rv3305c in Mycobacterium tuberculosis H37Rv

Annotation: Possible N-acyl-L-amino acid amidohydrolase AmiA1 (N-acyl-L-amino acid aminohydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01891: amidohydrolase
  • amino acids 18 to 375 (358 residues), 325.9 bits, E=1.7e-101
• PF01546: Peptidase_M20
  • amino acids 75 to 385 (311 residues), 120.4 bits, E=5e-39

Best Hits

Swiss-Prot: 39% identical to Y100_SYNY3: Uncharacterized hydrolase sll0100 (sll0100) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01436, amidohydrolase [EC: 3.5.1.-] (inferred from 100% identity to mbt:JTY_3330)

Predicted SEED Role

"N-acyl-L-amino acid amidohydrolase AmiA1 (EC 3.5.1.-)" (EC 3.5.1.-)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (389 amino acids)

>Rv3305c Possible N-acyl-L-amino acid amidohydrolase AmiA1 (N-acyl-L-amino acid aminohydrolase) (Mycobacterium tuberculosis H37Rv)
MSLADAAESWLAAHHDDLVGWRRHIHRYPELGRQEYATTQFVAERLADAGLNPKVLPGGT
GLTCDFGPQHQPRIALRADMDALPMAERTGAPYASTMPNVAHACGHDAHTAILLGAALAL
ASVPELPVGVRLIFQAAEELMPGGAIDAIAAGALAGVSRIFALHCDPRLEVGKVAVRQGP
ITSAADSIEITLYSPGGHTSRPHLTADLVYGLGTLVTGLPGVLSRRIDPRNSTVLVWGAV
NAGMAANAIPQTGVLSGTVRTASRQTWVDLEELVRQAISALLLPLAIEHTLQYRRGVPPV
VNEEISTRILAHAIEAIGPGVLADTRQSGGGEDFSWYLEEVPGAMARLGVWSGDGLQLDL
HQPTFDIDERALAIGLRVMVNIIEQAAAH