Protein Info for Rv3301c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphate-transport system transcriptional regulatory protein PhoU homolog 1 PhoY1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 5 to 210 (206 residues), 167.9 bits, see alignment E=1.2e-53 PF01895: PhoU" amino acids 17 to 103 (87 residues), 61.5 bits, see alignment E=4.2e-21 amino acids 122 to 204 (83 residues), 39.5 bits, see alignment E=3e-14

Best Hits

Swiss-Prot: 100% identical to PHOU1_MYCTU: Phosphate-specific transport system accessory protein PhoU homolog 1 (phoU1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02039, phosphate transport system protein (inferred from 100% identity to mbt:JTY_3366)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>Rv3301c Probable phosphate-transport system transcriptional regulatory protein PhoU homolog 1 PhoY1 (Mycobacterium tuberculosis H37Rv)
MRTVYHQRLTELAGRLGEMCSLAGIAMKRATQALLEADIGAAEQVIRDHERIVAMRAQVE
KEAFALLALQHPVAGELREIFSAVQIIADTERMGALAVHIAKITRREYPNQVLPEEVRNC
FADMAKVAIALGDSARQVLVNRDPQEAAQLHDRDDAMDDLHRHLLSVLIDREWRHGVRVG
VETALLGRFFERFADHAVEVGRRVIFMVTGVLPTEDEISTY