Protein Info for Rv3298c in Mycobacterium tuberculosis H37Rv

Annotation: Possible esterase lipoprotein LpqC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF10503: Esterase_PHB" amino acids 43 to 191 (149 residues), 32.5 bits, see alignment E=5.7e-12 PF00326: Peptidase_S9" amino acids 117 to 167 (51 residues), 23.6 bits, see alignment 3.5e-09

Best Hits

KEGG orthology group: K03932, polyhydroxybutyrate depolymerase (inferred from 100% identity to mbt:JTY_3323)

Predicted SEED Role

"POSSIBLE ESTERASE LIPOPROTEIN LPQC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>Rv3298c Possible esterase lipoprotein LpqC (Mycobacterium tuberculosis H37Rv)
MPWARMLSLIVLMVCLAGCGGDQLLARHASSVATFQFGGLTRSYRLHVPPAEPSGLVISL
HGGGGTGAGQEALTDFDAVADAADLLVVYPDGYDKSWADGRGASPADRRHLDDVGFLVAL
AAKLVHDFDIAPGHVFATGMSNGGFMSNRLACDRADIFAAVAPVAGTLGVGVTCNPSRPV
SVLEAHGTADPLVPFNGGAVRGRGGLSHSISVASLVDRWRAVDGCQGDPSAAELPDVGDG
TMVHLFDSSSCAAGTEVISYQIDNGGHTWPGGRQYLPKAVIGATTRAFDGSQVIAQFFAT
HGRD