Protein Info for Rv3286c in Mycobacterium tuberculosis H37Rv

Annotation: Alternative RNA polymerase sigma factor SigF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR02980: RNA polymerase sigma-70 factor, sigma-B/F/G subfamily" amino acids 38 to 260 (223 residues), 301.1 bits, see alignment E=5.6e-94 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 40 to 260 (221 residues), 116.3 bits, see alignment E=1.1e-37 PF04542: Sigma70_r2" amino acids 43 to 112 (70 residues), 52.3 bits, see alignment E=8.1e-18 PF04539: Sigma70_r3" amino acids 126 to 188 (63 residues), 42.5 bits, see alignment E=1.2e-14 PF08281: Sigma70_r4_2" amino acids 206 to 256 (51 residues), 40.7 bits, see alignment 2.9e-14 PF04545: Sigma70_r4" amino acids 209 to 257 (49 residues), 62.2 bits, see alignment 5.4e-21

Best Hits

Swiss-Prot: 100% identical to SIGF_MYCTO: RNA polymerase sigma factor SigF (sigF) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03090, RNA polymerase sigma-B factor (inferred from 100% identity to mbt:JTY_3311)

Predicted SEED Role

"RNA polymerase sigma factor SigB" in subsystem Biofilm formation in Staphylococcus or Methicillin resistance in Staphylococci or SigmaB stress responce regulation or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>Rv3286c Alternative RNA polymerase sigma factor SigF (Mycobacterium tuberculosis H37Rv)
VTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEG
RGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRL
KELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSD
DDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGI
SQMHVSRLLAKSLARLRDQLE