Protein Info for Rv3285 in Mycobacterium tuberculosis H37Rv

Annotation: Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00289: Biotin_carb_N
  • amino acids 12 to 120 (109 residues), 148.3 bits, E=4e-47
• PF02786: CPSase_L_D2
  • amino acids 125 to 333 (209 residues), 260.3 bits, E=4.3e-81
• PF02222: ATP-grasp
  • amino acids 149 to 302 (154 residues), 32.3 bits, E=2.8e-11
• PF07478: Dala_Dala_lig_C
  • amino acids 155 to 301 (147 residues), 25.1 bits, E=4e-09
• PF02785: Biotin_carb_C
  • amino acids 345 to 455 (111 residues), 119.9 bits, E=1.9e-38
• PF00364: Biotin_lipoyl
  • amino acids 534 to 599 (66 residues), 64 bits, E=3.2e-21

Best Hits

Swiss-Prot: 88% identical to BCCA_MYCLE: Acetyl-/propionyl-coenzyme A carboxylase alpha chain (bccA) from Mycobacterium leprae (strain TN)

KEGG orthology group: K11263, acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC: 6.3.4.14] (inferred from 100% identity to mtu:Rv3285)

MetaCyc: 100% identical to acetyl/propionyl-CoA carboxylase alpha chain (Mycobacterium tuberculosis H37Rv)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) / Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

• superpathway of fatty acid biosynthesis II (plant) (34/43 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• superpathway of fatty acids biosynthesis (E. coli) (39/53 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (11/16 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• candicidin biosynthesis (1/6 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• glyoxylate assimilation (4/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14

Use Curated BLAST to search for 2.1.3.15 or 6.3.4.14

Protein Sequence (600 amino acids)

>Rv3285 Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP) (Mycobacterium tuberculosis H37Rv)
VASHAGSRIARISKVLVANRGEIAVRVIRAARDAGLPSVAVYAEPDAESPHVRLADEAFA
LGGQTSAESYLDFAKILDAAAKSGANAIHPGYGFLAENADFAQAVIDAGLIWIGPSPQSI
RDLGDKVTARHIAARAQAPLVPGTPDPVKGADEVVAFAEEYGLPIAIKAAHGGGGKGMKV
ARTIDEIPELYESAVREATAAFGRGECYVERYLDKPRHVEAQVIADQHGNVVVAGTRDCS
LQRRYQKLVEEAPAPFLTDFQRKEIHDSAKRICKEAHYHGAGTVEYLVGQDGLISFLEVN
TRLQVEHPVTEETAGIDLVLQQFRIANGEKLDITEDPTPRGHAIEFRINGEDAGRNFLPA
PGPVTKFHPPSGPGVRVDSGVETGSVIGGQFDSMLAKLIVHGADRAEALARARRALNEFG
VEGLATVIPFHRAVVSDPAFIGDANGFSVHTRWIETEWNNTIEPFTDGEPLDEDARPRQK
VVVEIDGRRVEVSLPADLALSNGGGCDPVGVIRRKPKPRKRGAHTGAAASGDAVTAPMQG
TVVKFAVEEGQEVVAGDLVVVLEAMKMENPVTAHKDGTITGLAVEAGAAITQGTVLAEIK