Protein Info for Rv3285 in Mycobacterium tuberculosis H37Rv

Annotation: Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 PF00289: Biotin_carb_N" amino acids 12 to 120 (109 residues), 148.5 bits, see alignment E=3.3e-47 PF02786: CPSase_L_D2" amino acids 125 to 333 (209 residues), 260.3 bits, see alignment E=4.3e-81 PF02222: ATP-grasp" amino acids 149 to 302 (154 residues), 32.3 bits, see alignment E=2.8e-11 PF07478: Dala_Dala_lig_C" amino acids 155 to 301 (147 residues), 25.1 bits, see alignment E=4e-09 PF02785: Biotin_carb_C" amino acids 345 to 455 (111 residues), 119.9 bits, see alignment E=1.9e-38 PF00364: Biotin_lipoyl" amino acids 534 to 599 (66 residues), 64 bits, see alignment E=3.2e-21

Best Hits

Swiss-Prot: 88% identical to BCCA_MYCLE: Acetyl-/propionyl-coenzyme A carboxylase alpha chain (bccA) from Mycobacterium leprae (strain TN)

KEGG orthology group: K11263, acetyl-/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC: 6.3.4.14] (inferred from 100% identity to mtu:Rv3285)

MetaCyc: 100% identical to acetyl/propionyl-CoA carboxylase alpha chain (Mycobacterium tuberculosis H37Rv)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) / Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14

Use Curated BLAST to search for 2.1.3.15 or 6.3.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>Rv3285 Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP) (Mycobacterium tuberculosis H37Rv)
VASHAGSRIARISKVLVANRGEIAVRVIRAARDAGLPSVAVYAEPDAESPHVRLADEAFA
LGGQTSAESYLDFAKILDAAAKSGANAIHPGYGFLAENADFAQAVIDAGLIWIGPSPQSI
RDLGDKVTARHIAARAQAPLVPGTPDPVKGADEVVAFAEEYGLPIAIKAAHGGGGKGMKV
ARTIDEIPELYESAVREATAAFGRGECYVERYLDKPRHVEAQVIADQHGNVVVAGTRDCS
LQRRYQKLVEEAPAPFLTDFQRKEIHDSAKRICKEAHYHGAGTVEYLVGQDGLISFLEVN
TRLQVEHPVTEETAGIDLVLQQFRIANGEKLDITEDPTPRGHAIEFRINGEDAGRNFLPA
PGPVTKFHPPSGPGVRVDSGVETGSVIGGQFDSMLAKLIVHGADRAEALARARRALNEFG
VEGLATVIPFHRAVVSDPAFIGDANGFSVHTRWIETEWNNTIEPFTDGEPLDEDARPRQK
VVVEIDGRRVEVSLPADLALSNGGGCDPVGVIRRKPKPRKRGAHTGAAASGDAVTAPMQG
TVVKFAVEEGQEVVAGDLVVVLEAMKMENPVTAHKDGTITGLAVEAGAAITQGTVLAEIK