Protein Info for Rv3283 in Mycobacterium tuberculosis H37Rv

Annotation: Probable thiosulfate sulfurtransferase SseA (rhodanese) (thiosulfate cyanide transsulfurase) (thiosulfate thiotransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00581: Rhodanese" amino acids 22 to 131 (110 residues), 52 bits, see alignment E=4.1e-18 amino acids 164 to 279 (116 residues), 64.6 bits, see alignment E=4.9e-22

Best Hits

Swiss-Prot: 100% identical to THT2_MYCTO: Putative thiosulfate sulfurtransferase SseA (sseA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01011, thiosulfate/3-mercaptopyruvate sulfurtransferase [EC: 2.8.1.1 2.8.1.2] (inferred from 99% identity to mbo:Mb3311)

MetaCyc: 59% identical to TTuD sulfur-carrier protein (Thermus thermophilus)
2.8.1.M4 [EC: 2.8.1.M4]

Predicted SEED Role

"Thiosulfate sulfurtransferase, rhodanese (EC 2.8.1.1)" (EC 2.8.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1, 2.8.1.2

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.2 or 2.8.1.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>Rv3283 Probable thiosulfate sulfurtransferase SseA (rhodanese) (thiosulfate cyanide transsulfurase) (thiosulfate thiotransferase) (Mycobacterium tuberculosis H37Rv)
VPLPADPSPTLSAYAHPERLVTADWLSAHMGAPGLAIVESDEDVLLYDVGHIPGAVKIDW
HTDLNDPRVRDYINGEQFAELMDRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVR
LLNGGRDLWLAERRETTLDVPTKTCTGYPVVQRNDAPIRAFRDDVLAILGAQPLIDVRSP
EEYTGKRTHMPDYPEEGALRAGHIPTAVHIPWGKAADESGRFRSREELERLYDFINPDDQ
TVVYCRIGERSSHTWFVLTHLLGKADVRNYDGSWTEWGNAVRVPIVAGEEPGVVPVV