Protein Info for Rv3276c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoribosylaminoimidazole carboxylase ATPase subunit PurK (air carboxylase) (AIRC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF22660: RS_preATP-grasp-like" amino acids 20 to 115 (96 residues), 74.8 bits, see alignment E=1.5e-24 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 20 to 384 (365 residues), 445.8 bits, see alignment E=6.7e-138 PF02786: CPSase_L_D2" amino acids 116 to 279 (164 residues), 31.9 bits, see alignment E=2.5e-11 PF02222: ATP-grasp" amino acids 123 to 302 (180 residues), 208 bits, see alignment E=2.3e-65 PF17769: PurK_C" amino acids 324 to 384 (61 residues), 58.1 bits, see alignment E=1.4e-19

Best Hits

Swiss-Prot: 100% identical to PURK_MYCTU: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to mra:MRA_3317)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>Rv3276c Probable phosphoribosylaminoimidazole carboxylase ATPase subunit PurK (air carboxylase) (AIRC) (Mycobacterium tuberculosis H37Rv)
MMAVASSRTPAVTSFIAPLVAMVGGGQLARMTHQAAIALGQNLRVLVTSADDPAAQVTPN
VVIGSHTDLAALRRVAAGADVLTFDHEHVPNELLEKLVADGVNVAPSPQALVHAQDKLVM
RQRLAAAGVAVPRYAGIKDPDEIDVFAARVDAPIVVKAVRGGYDGRGVRMARDVADARDF
ARECLADGVAVLVEERVDLRRELSALVARSPFGQGAAWPVVQTVQRDGTCVLVIAPAPAL
PDDLATAAQRLALQLADELGVVGVLAVELFETTDGALLVNELAMRPHNSGHWTIDGARTS
QFEQHLRAVLDYPLGDSDAVVPVTVMANVLGAAQPPAMSVDERLHHLFARMPDARVHLYG
KAERPGRKVGHINFLGSDVAQLCERAELAAHWLSHGRWTDGWDPHRASDDAVGVPPACGG
RSDEEERRL