Protein Info for Rv3275c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoribosylaminoimidazole carboxylase catalytic subunit PurE (air carboxylase) (AIRC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 9 to 153 (145 residues), 214.4 bits, E=2.5e-68
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 10 to 164 (155 residues), 219.6 bits, E=7.4e-70

Best Hits

Swiss-Prot: 100% identical to PURE_MYCTU: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 99% identity to mbb:BCG_3304c)

MetaCyc: 50% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• inosine-5'-phosphate biosynthesis I (6/6 steps found)
• inosine-5'-phosphate biosynthesis II (5/5 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Protein Sequence (174 amino acids)

>Rv3275c Probable phosphoribosylaminoimidazole carboxylase catalytic subunit PurE (air carboxylase) (AIRC) (Mycobacterium tuberculosis H37Rv)
MTPAGERPRVGVIMGSDSDWPVMADAAAALAEFDIPAEVRVVSAHRTPEAMFSYARGAAE
RGLEVIIAGAGGAAHLPGMVAAATPLPVIGVPVPLGRLDGLDSLLSIVQMPAGVPVATVS
IGGAGNAGLLAVRMLGAANPQLRARIVAFQDRLADVVAAKDAELQRLAGKLTRD