Protein Info for Rv3274c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF02771: Acyl-CoA_dh_N" amino acids 17 to 125 (109 residues), 108.5 bits, see alignment E=4.9e-35 PF02770: Acyl-CoA_dh_M" amino acids 131 to 226 (96 residues), 100.3 bits, see alignment E=1.1e-32 PF00441: Acyl-CoA_dh_1" amino acids 238 to 388 (151 residues), 170.7 bits, see alignment E=5e-54 PF08028: Acyl-CoA_dh_2" amino acids 254 to 376 (123 residues), 95.7 bits, see alignment E=5.6e-31

Best Hits

Swiss-Prot: 100% identical to ACDP_MYCTO: Probable acyl-CoA dehydrogenase fadE25 (fadE25) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mbt:JTY_3299)

MetaCyc: 71% identical to 5-carboxy-2-pentenoyl-CoA reductase (Thermobifida fusca B6)
RXN-22975

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>Rv3274c Probable acyl-CoA dehydrogenase FadE25 (Mycobacterium tuberculosis H37Rv)
MVGWAGNPSFDLFKLPEEHDEMRSAIRALAEKEIAPHAAEVDEKARFPEEALVALNSSGF
NAVHIPEEYGGQGADSVATCIVIEEVARVDASASLIPAVNKLGTMGLILRGSEELKKQVL
PALAAEGAMASYALSEREAGSDAASMRTRAKADGDHWILNGAKCWITNGGKSTWYTVMAV
TDPDRGANGISAFMVHKDDEGFTVGPKERKLGIKGSPTTELYFENCRIPGDRIIGEPGTG
FKTALATLDHTRPTIGAQAVGIAQGALDAAIAYTKDRKQFGESISTFQAVQFMLADMAMK
VEAARLMVYSAAARAERGEPDLGFISAASKCFASDVAMEVTTDAVQLFGGAGYTTDFPVE
RFMRDAKITQIYEGTNQIQRVVMSRALLR