Protein Info for Rv3272 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF02515: CoA_transf_3" amino acids 10 to 387 (378 residues), 394.2 bits, see alignment E=3.1e-122

Best Hits

Swiss-Prot: 100% identical to COATR_MYCTU: Probable fatty acyl-CoA transferase Rv3272 (Rv3272) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_3301)

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F (EC 2.8.3.16)" (EC 2.8.3.16)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>Rv3272 Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MPTSNPAKPLDGFRVLDFTQNVAGPLAGQVLVDLGAEVIKVEAPGGEAARQITSVLPGRP
PLATYFLPNNRGKKSVTVDLTTEQAKQQMLRLADTADVVLEAFRPGTMEKLGLGPDDLRS
RNPNLIYARLTAYGGNGPHGSRPGIDLVVAAEAGMTTGMPTPEGKPQIIPFQLVDNASGH
VLAQAVLAALLHRERNGVADVVQVAMYDVAVGLQANQLMMHLNRAASDQPKPEPAPKAKR
RKGVGFATQPSDAFRTADGYIVISAYVPKHWQKLCYLIGRPDLVEDQRFAEQRSRSINYA
ELTAELELALASKTATEWVQLLQANGLMACLAHTWKQVVDTPLFAENDLTLEVGRGADTI
TVIRTPARYASFRAVVTDPPPTAGEHNAVFLARP