Protein Info for Rv3271c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 101 to 117 (17 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 38 to 213 (176 residues), 31.9 bits, see alignment E=5.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03319)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>Rv3271c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
METTTEHRDESTLDSPVSVAREAEWQRNVRWARWLAWVSLAVLLTEGAVGLWQGIAVGSV
ALTGWALGGGSEGLASAMVLWRFTGDRTWSATAEHRAQRGVAVSFWLTAPYLVAESIRHL
AGEHRAETSVIGIGLTAIALLLMPVLGWANHRVGERLGSGATAGEGTQNYLCAAQAAAVL
LGLAITAVWSNGWWIDPAIGLAIAGIAVWQGIRTWRGHGCGC