Protein Info for Rv3264c in Mycobacterium tuberculosis H37Rv

Annotation: D-alpha-D-mannose-1-phosphate guanylyltransferase ManB (D-alpha-D-heptose-1-phosphate guanylyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF12804: NTP_transf_3" amino acids 8 to 134 (127 residues), 42.2 bits, see alignment E=2.4e-14 PF00483: NTP_transferase" amino acids 8 to 236 (229 residues), 162.8 bits, see alignment E=2.7e-51 PF25087: GMPPB_C" amino acids 251 to 334 (84 residues), 51.5 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K00966, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.13] (inferred from 100% identity to mbt:JTY_3289)

Predicted SEED Role

"D-glycero-D-manno-heptose 1-phosphate guanosyltransferase" in subsystem Capsular heptose biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>Rv3264c D-alpha-D-mannose-1-phosphate guanylyltransferase ManB (D-alpha-D-heptose-1-phosphate guanylyltransferase) (Mycobacterium tuberculosis H37Rv)
LATHQVDAVVLVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAAGIEHVILGTSY
KPAVFEAEFGDGSALGLQIEYVTEEHPLGTGGGIANVAGKLRNDTAMVFNGDVLSGADLA
QLLDFHRSNRADVTLQLVRVGDPRAFGCVPTDEEDRVVAFLEKTEDPPTDQINAGCYVFE
RNVIDRIPQGREVSVEREVFPALLADGDCKIYGYVDASYWRDMGTPEDFVRGSADLVRGI
APSPALRGHRGEQLVHDGAAVSPGALLIGGTVVGRGAEIGPGTRLDGAVIFDGVRVEAGC
VIERSIIGFGARIGPRALIRDGVIGDGADIGARCELLSGARVWPGVFLPDGGIRYSSDV