Protein Info for Rv3263 in Mycobacterium tuberculosis H37Rv

Annotation: Probable DNA methylase (modification methylase) (methyltransferase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF02384: N6_Mtase" amino acids 31 to 188 (158 residues), 21.5 bits, see alignment E=2e-08 PF07669: Eco57I" amino acids 100 to 216 (117 residues), 42 bits, see alignment E=1.7e-14 PF22837: M_Eco57I_C" amino acids 269 to 521 (253 residues), 303.3 bits, see alignment E=1.6e-94

Best Hits

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mbo:Mb3291)

Predicted SEED Role

"probable DNA methylase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>Rv3263 Probable DNA methylase (modification methylase) (methyltransferase) (Mycobacterium tuberculosis H37Rv)
MQPSHPTRPGAVIRYVGSSLDTCPMTTFAGKTAASADKVRGGYYTPPAVARFLAHWVHQA
GPKILEPSCGDGRILRELSAITDHAHGVELVAREAKKSRDFASVDTENLFTWLHKTQLGS
WDGVAGNPPYIRFGNWASEQRDPALELMRRVGLRPTKLTNAWVPFVVASTTLARDGGRVG
LVVPAELLQVTYAAQLREFLLSRYREITLVTFERLVFDGILQEVVLFCGVVGPGPAHIRT
VRLGDANDLNALGDKDFTNESAPALLHEKEKWTKYFLDPAQIRLLRGLKQSATMIRLGEL
ADVDVGIVTGRNSFFTFTDAKAQALGLRAHCVPLVSRSAQLSGLIYDEDCRACDVAGNHR
TWLLDAADYPTDPALVAHITAGEAAGVHLGYKCSIRKPWWSTPSLWMPDLFMLRQIHFAP
RLTVNAAAATSTDTVHRVRLDPNVDPATLAAVFHNSATFAFAEIMGRSYGGGILELEPRE
AEQLPMPPPAYGSAELAQDVDLLLKANEIDKALDVVDRHVLIDGLGLSPRLVAGCRAAWL
TLRDRRTKRGSRR