Protein Info for Rv3257c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphomannomutase PmmA (PMM) (phosphomannose mutase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 12 to 128 (117 residues), 111.1 bits, E=6.9e-36
• PF02879: PGM_PMM_II
  • amino acids 160 to 259 (100 residues), 83.5 bits, E=2.9e-27
• PF02880: PGM_PMM_III
  • amino acids 269 to 373 (105 residues), 92.5 bits, E=4e-30
• PF00408: PGM_PMM_IV
  • amino acids 378 to 454 (77 residues), 40.5 bits, E=4.6e-14

Best Hits

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to mbo:Mb3285c)

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (33/33 steps found)
• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (8/8 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• chitin biosynthesis (6/9 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• starch biosynthesis (6/10 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2, 5.4.2.8

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Protein Sequence (465 amino acids)

>Rv3257c Probable phosphomannomutase PmmA (PMM) (phosphomannose mutase) (Mycobacterium tuberculosis H37Rv)
MSWPAAAVDRVIKAYDVRGLVGEEIDESLVTDLGAAFARLMRTEDARPVVIGHDMRDSSP
SLADAFAAGVTGQGLDVVRVGLASTDQLYFASGLLDCPGAMFTASHNPAAYNGIKMCRAA
AKPVGADTGLTAIRDDLIAGVARYDGTPGTIADQDVLVDYGAFLRSLVDTSGLRPLRVAV
DAGNGMAGHTAPAVLGVIDSITLLPSYFELDGSFPNHEANPLDPANLVDLQAYVRDTGAD
IGLAFDGDADRCFVVDERGQPVSPSTVTALVAARELNREIGATIIHNVITSRAVPELVAE
RGGTPLRSRVGHSYIKALMAETGAIFGGEHSAHYYFRDFWGADSGMLAALHVLAALGEQS
RPLSELTADYQRYESSGEINFTVVDSSACVEAVLKSFGNRIVSIDHLDGVTVDLGDDSWF
NLRSSNTEPLLRLNVEGRSVGDVDAVVRQVSAEIAAQSAHAKAGP