Protein Info for Rv3253c in Mycobacterium tuberculosis H37Rv

Annotation: Possible cationic amino acid transport integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 457 to 475 (19 residues), see Phobius details PF13520: AA_permease_2" amino acids 28 to 453 (426 residues), 192.2 bits, see alignment E=2.4e-60 PF00324: AA_permease" amino acids 33 to 451 (419 residues), 137.5 bits, see alignment E=8.4e-44 PF13906: AA_permease_C" amino acids 430 to 480 (51 residues), 65.2 bits, see alignment 6.8e-22

Best Hits

KEGG orthology group: K03294, basic amino acid/polyamine antiporter, APA family (inferred from 100% identity to mbb:BCG_3282c)

Predicted SEED Role

"Amino acid permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>Rv3253c Possible cationic amino acid transport integral membrane protein (Mycobacterium tuberculosis H37Rv)
MAGRRRMKSVEQSIADTDEPTTRLRKDLTWWDLVVFGVSVVIGAGIFTVTASTAGDITGP
AIWISFLIAAATCALAALCYAEFASTLPVAGSAYTFSYATFGEFLAWVIGWNLVLELAMG
AAVVAKGWSSYLGTVFGFGNGTGHLGSLQLDWGALVIVTLVATLIALGTKLSSRFSAVVT
AIKVSVVVLVVVVGAFYIRAANYSPFIPEPEVQHHGGGLDQSVFSLLTGAQGSHYGWYGV
LAGASIVFFAFIGFDIVATMAEETKRPQRDVPRGILASLGVVTLLYVAVSVVLSGMVPYT
QLRTVPGRGPANLATAFQANGVYWASGIISVGALAGLTTVVMVLMLGQCRVLFAMARDGL
VPRQLAKTGSRGTPVRVTVLVAVLVATTASVFPITKLEEMVNVGTLFAFILVSAGVVVLR
RTRPDLQRGFTAPWVPLLPIAAVCACLWLMLNLTALTWIRFGIWLVAGTAIYVGYGRRHS
AQGLRQARESATRRC