Protein Info for Rv3252c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transmembrane alkane 1-monooxygenase AlkB (alkane 1-hydroxylase) (lauric acid omega-hydroxylase) (omega-hydroxylase) (fatty acid omega-hydroxylase) (alkane hydroxylase-rubredoxin)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 138 to 371 (234 residues), 130.9 bits, see alignment E=3.5e-42

Best Hits

KEGG orthology group: K00496, alkane 1-monooxygenase [EC: 1.14.15.3] (inferred from 100% identity to mtb:TBMG_03300)

MetaCyc: 100% identical to alkane hydroxylase (Mycobacterium tuberculosis H37Rv)
Alkane 1-monooxygenase. [EC: 1.14.15.3]

Predicted SEED Role

"Alkane-1 monooxygenase (EC 1.14.15.3)" (EC 1.14.15.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.15.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>Rv3252c Probable transmembrane alkane 1-monooxygenase AlkB (alkane 1-hydroxylase) (lauric acid omega-hydroxylase) (omega-hydroxylase) (fatty acid omega-hydroxylase) (alkane hydroxylase-rubredoxin) (Mycobacterium tuberculosis H37Rv)
MTTQIGSGGPEAPRPPEVEEWRDKKRYLWLMGLIAPTALVVMLPLIWGMNQLGWHAAAQV
PLWIGPILLYVLLPLLDLRFGPDGQNPPDEVTDRLENDKYYRYCTYIYIPFQYLSVVLGA
YLFTAANLSWLGFDGALSWAGKLGVALSVGVLGGVGINTAHEMGHKKDSLERWLSKITLA
QTCYGHFYIEHNRGHHVRVSTPEDPASARFGETLWEFLPRSVIGGLRSAVHLEAQRLRRL
GVSPWNPMTYLRNDVLNAWLMSVVLWGGLIAVFGPALIPFVIIQAVFGFSLLEAVNYLEH
YGLLRQKSANGRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRYQTLRSMAGAP
NLPSGYASMISLTYFPPLWRKVMDHRVLEHYGGDITRVNLHPRVREKALARYGASA