Protein Info for Rv3245c in Mycobacterium tuberculosis H37Rv

Annotation: Two component sensory transduction histidine kinase MtrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details PF00672: HAMP" amino acids 232 to 283 (52 residues), 46.3 bits, see alignment 8.4e-16 PF00512: HisKA" amino acids 296 to 362 (67 residues), 61.4 bits, see alignment E=1.4e-20 PF13581: HATPase_c_2" amino acids 401 to 485 (85 residues), 28 bits, see alignment E=3.7e-10 PF02518: HATPase_c" amino acids 409 to 517 (109 residues), 83.2 bits, see alignment E=3.7e-27

Best Hits

Swiss-Prot: 100% identical to MTRB_MYCTU: Sensor histidine kinase MtrB (mtrB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07654, two-component system, OmpR family, sensor histidine kinase MtrB [EC: 2.7.13.3] (inferred from 100% identity to mtc:MT3343)

Predicted SEED Role

"Sensor histidine kinase MtrB (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>Rv3245c Two component sensory transduction histidine kinase MtrB (Mycobacterium tuberculosis H37Rv)
MIFGSRRRIRGRRGRSGPMTRGLSALSRAVAVAWRRSLQLRVVALTLGLSLAVILALGFV
LTSQVTNRVLDIKVRAAIDQIERARTTVSGIVNGEETRSLDSSLQLARNTLTSKTDPASG
AGLAGAFDAVLMVPGDGPRAASTAGPVDQVPNALRGFVKAGQAAYQYATVQTEGFSGPAL
IIGTPTLSRVANLELYLIFPLASEQATITLVRGTMATGGLVLLVLLAGIALLVSRQVVVP
VRSASRIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQIAQLEEFGNLQRRFT
SDVSHELRTPLTTVRMAADLIYDHSADLDPTLRRSTELMVSELDRFETLLNDLLEISRHD
AGVAELSVEAVDLRTTVNNALGNVGHLAEEAGIELLVDLPAEQVIAEVDARRVERILRNL
IANAIDHAEHKPVRIRMAADEDTVAVTVRDYGVGLRPGEEKLVFSRFWRSDPSRVRRSGG
TGLGLAISVEDARLHQGRLEAWGEPGEGACFRLTLPMVRGHKVTTSPLPMKPIPQPVLQP
VAQPNPQPMPPEYKERQRPREHAEWSG