Protein Info for Rv3241c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR00741: ribosomal subunit interface protein" amino acids 15 to 118 (104 residues), 109 bits, see alignment E=7.3e-36 PF02482: Ribosomal_S30AE" amino acids 16 to 112 (97 residues), 71.6 bits, see alignment E=7.3e-24 PF16321: Ribosom_S30AE_C" amino acids 155 to 210 (56 residues), 92.1 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 100% identical to HPF_MYCTU: Ribosome hibernation promotion factor (hpf) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_03289)

Predicted SEED Role

"Ribosomal subunit interface protein" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>Rv3241c Conserved protein (Mycobacterium tuberculosis H37Rv)
VDSGQVLAEPKSNAEIVFKGRNVEIPDHFRIYVSQKLARLERFDRTIYLFDVELDHERNR
RQRKSCQRVEITARGRGPVVRGEACADSFYAALESAVVKLESRLRRGKDRRKVHYGDKTP
VSLAEATAVVPAPENGFNTRPAEAHDHDGAVVEREPGRIVRTKEHPAKPMSVDDALYQME
LVGHDFFLFYDKDTERPSVVYRRHAYDYGLIRLA