Protein Info for Rv3240c in Mycobacterium tuberculosis H37Rv

Annotation: Probable preprotein translocase SecA1 1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 949 PF07517: SecA_DEAD" amino acids 5 to 382 (378 residues), 418.6 bits, see alignment E=2.7e-129 TIGR00963: preprotein translocase, SecA subunit" amino acids 26 to 820 (795 residues), 1194.3 bits, see alignment E=0 PF01043: SecA_PP_bind" amino acids 232 to 339 (108 residues), 132.9 bits, see alignment E=1.5e-42 PF21090: P-loop_SecA" amino acids 398 to 611 (214 residues), 299.4 bits, see alignment E=2.6e-93 PF07516: SecA_SW" amino acids 613 to 833 (221 residues), 241.8 bits, see alignment E=1.4e-75

Best Hits

Swiss-Prot: 100% identical to SECA1_MYCTA: Protein translocase subunit SecA 1 (secA1) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 74% identity to asd:AS9A_3787)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (949 amino acids)

>Rv3240c Probable preprotein translocase SecA1 1 subunit (Mycobacterium tuberculosis H37Rv)
VLSKLLRLGEGRMVKRLKKVADYVGTLSDDVEKLTDAELRAKTDEFKRRLADQKNPETLD
DLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHLGNVAEMKTGEGKTLTCVLPAYLNAL
AGNGVHIVTVNDYLAKRDSEWMGRVHRFLGLQVGVILATMTPDERRVAYNADITYGTNNE
FGFDYLRDNMAHSLDDLVQRGHHYAIVDEVDSILIDEARTPLIISGPADGASNWYTEFAR
LAPLMEKDVHYEVDLRKRTVGVHEKGVEFVEDQLGIDNLYEAANSPLVSYLNNALKAKEL
FSRDKDYIVRDGEVLIVDEFTGRVLIGRRYNEGMHQAIEAKEHVEIKAENQTLATITLQN
YFRLYDKLAGMTGTAQTEAAELHEIYKLGVVSIPTNMPMIREDQSDLIYKTEEAKYIAVV
DDVAERYAKGQPVLIGTTSVERSEYLSRQFTKRRIPHNVLNAKYHEQEATIIAVAGRRGG
VTVATNMAGRGTDIVLGGNVDFLTDQRLRERGLDPVETPEEYEAAWHSELPIVKEEASKE
AKEVIEAGGLYVLGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDELMRRFNGAALE
TLLTRLNLPDDVPIEAKMVTRAIKSAQTQVEQQNFEVRKNVLKYDEVMNQQRKVIYAERR
RILEGENLKDQALDMVRDVITAYVDGATGEGYAEDWDLDALWTALKTLYPVGITADSLTR
KDHEFERDDLTREELLEALLKDAERAYAAREAELEEIAGEGAMRQLERNVLLNVIDRKWR
EHLYEMDYLKEGIGLRAMAQRDPLVEYQREGYDMFMAMLDGMKEESVGFLFNVTVEAVPA
PPVAPAAEPAELAEFAAAAAAAAQQRSAVDGGARERAPSALRAKGVASESPALTYSGPAE
DGSAQVQRNGGGAHKTPAGVPAGASRRERREAARRQGRGAKPPKSVKKR