Protein Info for Rv3230c in Mycobacterium tuberculosis H37Rv

Annotation: Hypothetical oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 170 to 187 (18 residues), see Phobius details PF00970: FAD_binding_6" amino acids 88 to 161 (74 residues), 35.9 bits, see alignment E=1.2e-12 PF00175: NAD_binding_1" amino acids 173 to 267 (95 residues), 35.2 bits, see alignment E=2.7e-12 PF00111: Fer2" amino acids 305 to 372 (68 residues), 42.7 bits, see alignment E=6.7e-15

Best Hits

Swiss-Prot: 100% identical to DESET_MYCTU: NADPH oxidoreductase (Rv3230c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbo:Mb3259c)

MetaCyc: 100% identical to stearoyl-CoA 9-desaturase electron-transfer subunit (Mycobacterium tuberculosis H37Rv)
1.14.19.M26 [EC: 1.14.19.M26]; 1.14.19.M26 [EC: 1.14.19.M26]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.14.19.M26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>Rv3230c Hypothetical oxidoreductase (Mycobacterium tuberculosis H37Rv)
MSKKHTTLNASIIDTRRPTVAGADRHPGWHALRKIAARITTPLLPDDYLHLANPLWSARE
LRGRILGVRRETEDSATLFIKPGWGFSFDYQPGQYIGIGLLVDGRWRWRSYSLTSSPAAS
GSARMVTVTVKAMPEGFLSTHLVAGVKPGTIVRLAAPQGNFVLPDPAPPLILFLTAGSGI
TPVMSMLRTLVRRNQITDVVHLHSAPTAADVMFGAELAALAADHPGYRLSVRETRAQGRL
DLTRIGQQVPDWRERQTWACGPEGVLNQADKVWSSAGASDRLHLERFAVSKTAPAGAGGT
VTFARSGKSVAADAATSLMDAGEGAGVQLPFGCRMGICQSCVVDLVEGHVRDLRTGQRHE
PGTRVQTCVSAASGDCVLDI