Protein Info for Rv3223c in Mycobacterium tuberculosis H37Rv

Annotation: Alternative RNA polymerase sigma-E factor (sigma-24) SigH (RPOE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR02947: RNA polymerase sigma-70 factor, TIGR02947 family" amino acids 19 to 207 (189 residues), 351.9 bits, see alignment E=8.3e-110 PF04542: Sigma70_r2" amino acids 37 to 99 (63 residues), 64 bits, see alignment E=1.3e-21 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 37 to 193 (157 residues), 85.8 bits, see alignment E=2.5e-28 PF08281: Sigma70_r4_2" amino acids 140 to 191 (52 residues), 60.2 bits, see alignment E=1.9e-20 PF04545: Sigma70_r4" amino acids 144 to 192 (49 residues), 39.9 bits, see alignment E=3.6e-14

Best Hits

Swiss-Prot: 100% identical to SIGH_MYCBO: ECF RNA polymerase sigma factor SigH (sigH) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to mbb:BCG_3251c)

Predicted SEED Role

"RNA polymerase sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>Rv3223c Alternative RNA polymerase sigma-E factor (sigma-24) SigH (RPOE) (Mycobacterium tuberculosis H37Rv)
MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQE
TMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEH
SSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
MSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS