Protein Info for Rv3221A in Mycobacterium tuberculosis H37Rv

Annotation: Anti-sigma factor RshA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 TIGR02949: anti-sigma factor, TIGR02949 family" amino acids 15 to 97 (83 residues), 107.7 bits, see alignment E=2.4e-35 TIGR03988: mycothiol system anti-sigma-R factor" amino acids 23 to 97 (75 residues), 103.2 bits, see alignment E=6.3e-34 PF13490: zf-HC2" amino acids 23 to 56 (34 residues), 40.7 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 99% identical to RSHA_MYCTU: Anti-sigma factor RshA (rshA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_3249c)

Predicted SEED Role

"Anti-sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>Rv3221A Anti-sigma factor RshA (Mycobacterium tuberculosis H37Rv)
VSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHLEACPGCLRHY
GLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGGP