Protein Info for Rv3220c in Mycobacterium tuberculosis H37Rv

Annotation: Probable two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 PF12282: GAF_PdtaS" amino acids 4 to 150 (147 residues), 152.2 bits, see alignment E=2.3e-48 PF07536: HWE_HK" amino acids 300 to 371 (72 residues), 34.6 bits, see alignment E=6.7e-12 PF07568: HisKA_2" amino acids 300 to 367 (68 residues), 77.6 bits, see alignment E=1.6e-25 PF13581: HATPase_c_2" amino acids 391 to 467 (77 residues), 29.5 bits, see alignment E=1.7e-10 PF02518: HATPase_c" amino acids 397 to 493 (97 residues), 46 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 100% identical to PDTAS_MYCTU: Probable sensor histidine kinase pdtaS (pdtaS) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to mbb:BCG_3247c)

Predicted SEED Role

"Signal transduction histidine kinase, subgroup 2"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>Rv3220c Probable two component sensor kinase (Mycobacterium tuberculosis H37Rv)
MSTLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPN
TGPTVVHTDAVGTVVAANSMPLVAATFSGGVPGREGAVGQQNSCQHDGHSVEVSPVRFGD
QVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDG
FIRLDVDGVVSYASPNALSAYHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLL
AGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKRRDRALISKDATIRE
IHHRVKNNLQTVAALLRLQARRTSNAEGREALIESVRRVSSIALVHDALSMSVDEQVNLD
EVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIMVITELVQNAIEHAFDPAAA
EGSVTIRAERSARWLDVVVHDDGLGLPQGFSLEKSDSLGLQIVRTLVSAELDGSLGMRDA
RERGTDVVLRVPVGRRGRLML