Protein Info for Rv3206c in Mycobacterium tuberculosis H37Rv

Annotation: Probable molybdenum cofactor biosynthesis protein MoeB1 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details PF00899: ThiF" amino acids 23 to 259 (237 residues), 259 bits, see alignment E=3.3e-81 PF00581: Rhodanese" amino acids 290 to 383 (94 residues), 64.9 bits, see alignment E=7.8e-22

Best Hits

Swiss-Prot: 100% identical to MOEZ_MYCTO: Probable adenylyltransferase/sulfurtransferase MoeZ (moeZ) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 100% identity to mtc:MT3301)

MetaCyc: 100% identical to [sulfur-carrier protein CysO]--sulfur ligase (Mycobacterium tuberculosis H37Rv)
6.2.1.-

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>Rv3206c Probable molybdenum cofactor biosynthesis protein MoeB1 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase) (Mycobacterium tuberculosis H37Rv)
VSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLY
LAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELR
LAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAP
DGLGVNYRDLYPEPPPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL
VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS
GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEAL
AAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY