Protein Info for Rv3203 in Mycobacterium tuberculosis H37Rv

Annotation: Possible lipase LipV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF12146: Hydrolase_4" amino acids 6 to 122 (117 residues), 40.1 bits, see alignment E=7e-14 PF12697: Abhydrolase_6" amino acids 7 to 216 (210 residues), 65.2 bits, see alignment E=3.6e-21 PF00561: Abhydrolase_1" amino acids 7 to 78 (72 residues), 50.2 bits, see alignment E=7.4e-17 PF06821: Ser_hydrolase" amino acids 27 to 79 (53 residues), 22.1 bits, see alignment E=3.1e-08 PF00975: Thioesterase" amino acids 32 to 74 (43 residues), 29.1 bits, see alignment 3e-10

Best Hits

Swiss-Prot: 100% identical to LIPV_MYCTU: Lipase LipV (lipV) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_3241)

Predicted SEED Role

"Lipase LipV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>Rv3203 Possible lipase LipV (Mycobacterium tuberculosis H37Rv)
LPEIPIAAPDLLGHGRSPWAAPWTIDANVSALAALLDNQGDGPVVVVGHSFGGAVAMHLA
AARPDQVAALVLLDPAVALDGSRVREVVDAMLASPDYLDPAEARAEKATGAWADVDPPVL
DAELDEHLVALPNGRYGWRISLPAMVCYWSELARDIVLPPVGTATTLVRAVRASPAYVSD
QLLAALDKRLGADFELLDFDCGHMVPQAKPTEVAAVIRSRLGPR