Protein Info for Rv3198c in Mycobacterium tuberculosis H37Rv

Annotation: Probable ATP-dependent DNA helicase II UvrD2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 PF00580: UvrD-helicase" amino acids 12 to 287 (276 residues), 190.1 bits, see alignment E=1.7e-59 PF13245: AAA_19" amino acids 16 to 271 (256 residues), 92.6 bits, see alignment E=6.1e-30 PF13361: UvrD_C" amino acids 292 to 430 (139 residues), 69 bits, see alignment E=1.3e-22 amino acids 456 to 560 (105 residues), 72.1 bits, see alignment E=1.5e-23 PF00570: HRDC" amino acids 630 to 696 (67 residues), 78.3 bits, see alignment E=8.8e-26

Best Hits

Swiss-Prot: 100% identical to UVRD2_MYCBO: ATP-dependent DNA helicase UvrD2 (uvrD2) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03657, DNA helicase II / ATP-dependent DNA helicase PcrA [EC: 3.6.4.12] (inferred from 100% identity to mbo:Mb3222c)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA, actinomycete paralog" in subsystem DNA repair, bacterial UvrD and related helicases

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (700 amino acids)

>Rv3198c Probable ATP-dependent DNA helicase II UvrD2 (Mycobacterium tuberculosis H37Rv)
MSIASDPLIAGLDDQQREAVLAPRGPVCVLAGAGTGKTRTITHRIASLVASGHVAAGQVL
AVTFTQRAAGEMRSRLRALDAAARTGSGVGAVQALTFHAAAYRQLRYFWSRVIADTGWQL
LDSKFAVVARAASRTRLHASTDDVRDLAGEIEWAKASLIGPEEYVTAVAAARRDPPLDAA
QIAAVYSEYEALKARGDGVTLLDFDDLLLHTAAAIENDAAVAEEFQDRYRCFVVDEYQDV
TPLQQRVLSAWLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDAAVVRLERDYRS
TPQVVSLANRVIAAARGRVAGSKLRLSGQREPGPVPSFHEHSDEPAEAATVAASIARLIA
SGTPPSEVAILYRVNAQSEVYEEALTQAGIAYQVRGGEGFFNRQEIKQALLALQRVSERD
TDAALSDVVRAVLAPLGLTAQPPVGTRARERWEALTALAELVDDELAQRPALQLPGLLAE
LRRRAEARHPPVVQGVTLASLHAAKGLEWDAVFLVGLADGTLPISHALAHGPNSEPVEEE
RRLLYVGITRARVHLALSWALSRSPGGRQSRKPSRFLNGIAPQTRADPVPGTSRRNRGAA
ARCRICNNELNTSAAVMLRRCETCAADVDEELLLQLKSWRLSTAKEQNVPAYVVFTDNTL
IAIAELLPTDDAALIAIPGIGARKLEQYGSDVLQLVRGRT