Protein Info for Rv3171c in Mycobacterium tuberculosis H37Rv

Annotation: Possible non-heme haloperoxidase Hpx

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF00561: Abhydrolase_1" amino acids 22 to 272 (251 residues), 85.9 bits, see alignment E=7.3e-28 PF12146: Hydrolase_4" amino acids 24 to 256 (233 residues), 68.4 bits, see alignment E=1.2e-22 PF12697: Abhydrolase_6" amino acids 24 to 278 (255 residues), 69.9 bits, see alignment E=1.1e-22 PF08386: Abhydrolase_4" amino acids 198 to 283 (86 residues), 21.9 bits, see alignment E=3.2e-08

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_3190)

Predicted SEED Role

"Non-heme haloperoxidase Hpx"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>Rv3171c Possible non-heme haloperoxidase Hpx (Mycobacterium tuberculosis H37Rv)
LTVRAADGTPLHTQVFGPPHGYPIVLTHGFVCAIRAWAYQIADLAGDYRVIAFDHRGHGR
SGVPRRGAYSLNHLAADLDSVLDATLAPRERAVVAGHSMGGITIAAWSDRYRHKVRRRTD
AVALINTTTGDLVRKVKLLSVPRELSPVRVLAGRSLVNTFGGFPLPGAARALSRHVISTL
AVAADADPSATRLVYELFTQTSAAGRGGCAKMLVEEVGSAHLNLDGLTVPTLVIGGVRDR
LTPISQSRRIARTAPNVVGLVELPGGHCSMLERHQEVNSHLRALAESVTRHVRDRRISS