Protein Info for Rv3170 in Mycobacterium tuberculosis H37Rv

Annotation: Probable flavin-containing monoamine oxidase AofH (amine oxidase) (MAO)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 9 to 45 (37 residues), 28.8 bits, 2.9e-10
• PF12831: FAD_oxidored
  • amino acids 9 to 49 (41 residues), 27.3 bits, 8e-10
• PF00890: FAD_binding_2
  • amino acids 9 to 46 (38 residues), 30.1 bits, 1e-10
• PF01266: DAO
  • amino acids 9 to 383 (375 residues), 48 bits, E=5e-16
• PF13450: NAD_binding_8
  • amino acids 12 to 76 (65 residues), 54 bits, E=5.8e-18
• PF01593: Amino_oxidase
  • amino acids 17 to 444 (428 residues), 282.4 bits, E=3.3e-87

Best Hits

Swiss-Prot: 100% identical to AOFH_MYCTU: Putative flavin-containing monoamine oxidase AofH (aofH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00274, monoamine oxidase [EC: 1.4.3.4] (inferred from 100% identity to mbt:JTY_3189)

Predicted SEED Role

"Amine oxidase [flavin-containing] (EC 1.4.3.4)" (EC 1.4.3.4)

MetaCyc Pathways

• noradrenaline and adrenaline degradation (12/13 steps found)
• phenylethylamine degradation I (2/2 steps found)
• dopamine degradation (4/5 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• putrescine degradation III (2/4 steps found)
• salidroside biosynthesis (2/4 steps found)
• serotonin degradation (4/7 steps found)
• L-tryptophan degradation VI (via tryptamine) (1/3 steps found)
• phenylethanol biosynthesis (2/5 steps found)
• melatonin degradation II (1/4 steps found)
• aromatic biogenic amine degradation (bacteria) (3/8 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• superpathway of melatonin degradation (1/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Arginine and proline metabolism
• Drug metabolism - cytochrome P450
• Glycine, serine and threonine metabolism
• Histidine metabolism
• Phenylalanine metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.4

Protein Sequence (448 amino acids)

>Rv3170 Probable flavin-containing monoamine oxidase AofH (amine oxidase) (MAO) (Mycobacterium tuberculosis H37Rv)
VTNPPWTVDVVVVGAGFAGLAAARELTRQGHEVLVFEGRDRVGGRSLTGRVAGVPADMGG
SFIGPTQDAVLALATELGIPTTPTHRDGRNVIQWRGSARSYRGTIPKLSLTGLIDIGRLR
WQFERIARGVPVAAPWDARRARELDDVSLGEWLRLVRATSSSRNLMAIMTRVTWGCEPDD
VSMLHAARYVRAAGGLDRLLDVKNGAQQDRVPGGTQQIAQAAAAQLGARVLLNAAVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRVAIEFDPPLPPEYQQLAHHWPQGRLSKAYAA
YSTPFWRASGYSGQALSDEAPVFITFDVSPHADGPGILMGFVDARGFDSLPIEERRRDAL
RCFASLFGDEALDPLDYVDYRWGTEEFAPGGPTAAVPPGSWTKYGHWLREPVGPIHWAST
ETADEWTGYFDGAVRSGQRAAAEVAALL