Protein Info for Rv3164c in Mycobacterium tuberculosis H37Rv

Annotation: Probable methanol dehydrogenase transcriptional regulatory protein MoxR3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF20030: bpMoxR" amino acids 13 to 203 (191 residues), 30.6 bits, see alignment E=5.2e-11 PF00158: Sigma54_activat" amino acids 32 to 152 (121 residues), 21.2 bits, see alignment E=6e-08 PF07726: AAA_3" amino acids 42 to 171 (130 residues), 211.5 bits, see alignment E=1e-66 PF07728: AAA_5" amino acids 48 to 170 (123 residues), 43.1 bits, see alignment E=1.3e-14 PF00004: AAA" amino acids 49 to 176 (128 residues), 21.5 bits, see alignment E=8.4e-08 PF17863: AAA_lid_2" amino acids 236 to 307 (72 residues), 73 bits, see alignment E=4.1e-24

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to mbo:Mb3189c)

Predicted SEED Role

"Probable methanol dehydrogenase transcriptional regulatory protein MoxR3"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>Rv3164c Probable methanol dehydrogenase transcriptional regulatory protein MoxR3 (Mycobacterium tuberculosis H37Rv)
MIMPAATTTAHCEAVLDEIERVVVGKRSALTLILTAVLARGHVLIEDLPGLGKTLIARSF
AAALGLDFTRVQFTPDLLPADLLGSTIYDMQSGRFEFRAGPIFTNLLLADEINRTPPKTQ
AALLEAMAEGQVSIDGQTHKLAMPFIVLATDNPIEYEGTYPLPEAQLDRFAIRLELRYLS
ERDETSMLRRRLERGSADPTVNQVVDCHDLLAMRESVEQVTVHEDVLHYVVSLANATRHH
PQVAVGASPRAELDLVQLSRARALLLGRDYVIPEDVKELATAAVAHRITLRPEMWVRKIA
GADVVSELLRRLPVPRISGT