Protein Info for Rv3161c in Mycobacterium tuberculosis H37Rv

Annotation: Possible dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 52 to 136 (85 residues), 72.7 bits, E=1.9e-24
• PF00848: Ring_hydroxyl_A
  • amino acids 188 to 371 (184 residues), 71.2 bits, E=1.2e-23

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbo:Mb3186c)

Predicted SEED Role

"Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit" in subsystem Phenylpropanoid compound degradation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (382 amino acids)

>Rv3161c Possible dioxygenase (Mycobacterium tuberculosis H37Rv)
MLSTDNRAELGDILTDIGDYLDDNPPALSLPPAAYTSSELWQLERERIFNRSWMLVAHVD
QVAKTGDYVTVSVAGEPVMVVRDVDGQLHALSPICRHRLMLMVEPGAGRIDTLTCQYHLW
RYGLDGRLRGAPHMAANLDFNRRECRLPQFAVATWNGLVWINLDADAEPIAAHLDLTDDE
FAGYRLGEMVQVESWSHEWRANWKVAAENGHENYHVLGLHRQTLEPFVPGGGDLDVRQYS
RWALRLRVPFTVPVEAKSLQLNEVQKSNLVVLWTFPNSALAIAGERVVWFGFIPQSIDRV
QVLGGVLTTPELAADAAATAQTSQFVMAMINDEDRLGLEAVQVGAGSRFAERGHLSSKEW
PGMLAFYRNLAMALVGDHPGAS