Protein Info for Rv3159c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE53

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 PF00823: PPE" amino acids 5 to 162 (158 residues), 190.8 bits, see alignment E=1.8e-60 PF01469: Pentapeptide_2" amino acids 190 to 229 (40 residues), 32.7 bits, see alignment 5.8e-12 amino acids 210 to 249 (40 residues), 30.9 bits, see alignment 2e-11 amino acids 250 to 288 (39 residues), 32.4 bits, see alignment 7.1e-12 amino acids 260 to 299 (40 residues), 31.5 bits, see alignment 1.3e-11 amino acids 339 to 376 (38 residues), 29.7 bits, see alignment 4.8e-11 amino acids 378 to 416 (39 residues), 32.6 bits, see alignment 6e-12 amino acids 448 to 483 (36 residues), 34.7 bits, see alignment 1.4e-12

Best Hits

Swiss-Prot: 63% identical to PPE16_MYCTU: Uncharacterized PPE family protein PPE16 (PPE16) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv3159c)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (590 amino acids)

>Rv3159c PPE family protein PPE53 (Mycobacterium tuberculosis H37Rv)
MNYSVLPPEINSLRMFTGAGSAPMLAASVAWDRLAAELAVAASSFGSVTSGLAGQSWQGA
AAAAMAAAAAPYAGWLAAAAARAAGASAQAKAVASAFEAARAATVHPMLVAANRNAFVQL
VLSNLFGQNAPAIAAAEAMYEQMWAADVAAMVGYHGGASAAAAQLSSWSIGLQQALPAAP
SALAAAIGLGNIGVGNLGGGNTGDYNLGSGNSGNANVGSGNSGNANVGSGNDGATNLGSG
NIGNTNLGSGNVGNVNLGSGNRGFGNLGNGNFGSGNLGSGNTGSTNFGGGNLGSFNLGSG
NIGSSNIGFGNNGDNNLGLGNNGNNNIGFGLTGDNLVGIGALNSGIGNLGFGNSGNNNIG
FFNSGNNNVGFFNSGNNNFGFGNAGDINTGFGNAGDTNTGFGNAGFFNMGIGNAGNEDMG
VGNGGSFNVGVGNAGNQSVGFGNAGTLNVGFANAGSINTGFANSGSINTGGFDSGDRNTG
FGSSVDQSVSSSGFGNTGMNSSGFFNTGNVSAGYGNNGDVQSGINNTNSGGFNVGFYNSG
AGTVGIANSGLQTTGIANSGTLNTGVANTGDHSSGGFNQGSDQSGFFGQP