Protein Info for Rv3158 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain N) NuoN (NADH-ubiquinone oxidoreductase chain N)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 417 to 439 (23 residues), see Phobius details amino acids 450 to 473 (24 residues), see Phobius details amino acids 496 to 515 (20 residues), see Phobius details TIGR01770: proton-translocating NADH-quinone oxidoreductase, chain N" amino acids 142 to 520 (379 residues), 383.8 bits, see alignment E=7.1e-119 PF00361: Proton_antipo_M" amino acids 169 to 466 (298 residues), 237.5 bits, see alignment E=9.4e-75

Best Hits

Swiss-Prot: 100% identical to NUON_MYCTU: NADH-quinone oxidoreductase subunit N (nuoN) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00343, NADH dehydrogenase I subunit N [EC: 1.6.5.3] (inferred from 100% identity to mtb:TBMG_03201)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>Rv3158 Probable NADH dehydrogenase I (chain N) NuoN (NADH-ubiquinone oxidoreductase chain N) (Mycobacterium tuberculosis H37Rv)
MILPAPHVEYFLLAPMLIVFSVAVAGVLAEAFLPRRWRYGAQVTLALGGSAVALIAVIVV
ARSIHGSGHAAVLGAIAVDRATLFLQGTVLLVTIMAVVFMAERSARVSPQRQNTLAVARL
PGLDSFTPQASAVPGSDAERQAERAGATQTELFPLAMLSVGGMMVFPASNDLLTMFVALE
VLSLPLYLMCGLARNRRLLSQEAAMKYFLLGAFSSAFFLYGVALLYGATGTLTLPGIRDA
LAARTDDSMALAGVALLAVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFGA
LLRVVYVALPPLHDQWRPVLWAIAILTMTVGTVTAVNQTNVKRMLAYSSVAHVGFILTGV
IADNPAGLSATLFYLVAYSFSTMGAFAIVGLVRGADGSAGSEDADLSHWAGLGQRSPIVG
VMLSMFLLAFAGIPLTSGFVSKFAVFRAAASAGAVPLVIVGVISSGVAAYFYVRVIVSMF
FTEESGDTPHVAAPGVLSKAAIAVCTVVTVVLGIAPQPVLDLADQAAQLLR