Protein Info for Rv3156 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain L) NuoL (NADH-ubiquinone oxidoreductase chain L)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 123 to 140 (18 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 311 to 339 (29 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 465 to 486 (22 residues), see Phobius details amino acids 507 to 527 (21 residues), see Phobius details amino acids 611 to 631 (21 residues), see Phobius details TIGR01974: proton-translocating NADH-quinone oxidoreductase, chain L" amino acids 9 to 627 (619 residues), 785.3 bits, see alignment E=3.1e-240 PF00662: Proton_antipo_N" amino acids 74 to 124 (51 residues), 76.9 bits, see alignment 8.6e-26 PF00361: Proton_antipo_M" amino acids 140 to 422 (283 residues), 265.6 bits, see alignment E=5.2e-83

Best Hits

Swiss-Prot: 100% identical to NUOL_MYCTU: NADH-quinone oxidoreductase subunit L (nuoL) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00341, NADH dehydrogenase I subunit L [EC: 1.6.5.3] (inferred from 100% identity to mtb:TBMG_03199)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>Rv3156 Probable NADH dehydrogenase I (chain L) NuoL (NADH-ubiquinone oxidoreductase chain L) (Mycobacterium tuberculosis H37Rv)
VTTSLGTHYTWLLVALPLAGAAILLFGGRRTDAWGHLLGCAAALAAFGVGAMLLADMLGR
DGLERAIHQQVFTWIPAGGLQVDFGLQIDQLSMCFVLLISGVGSLIHIYSVGYMAEDPDR
RRFFGYLNLFLASMLLLVVADNYVLLYVGWEGVGLASYLLIGFWYHKPSAATAAKKAFVM
NRVGDAGLAVGMFLTFSTFGTLSYAGVFAGVPAASRAVLTAIGLLMLLGACAKSAQVPLQ
AWLGDAMEGPTPVSALIHAATMVTAGVYLIVRSGPLYNLAPTAQLAVVIVGAVTLLFGAI
IGCAKDDIKRALAASTISQIGYMVLAAGLGPAGYAFAIMHLLTHGFFKAGLFLGSGAVIH
AMHEEQDMRRYGGLRAALPVTFATFGLAYLAIIGVPPFAGFFSKDAIIEAALGAGGIRGS
LLGGAALLGAGVTAFYMTRVMLMTFFGEKRWTPGAHPHEAPAVMTWPMILLAVGSVFSGG
LLAVGGTLRHWLQPVVGSHEEATHALPTWVATTLALGVVAVGIAVAYRMYGTAPIPRVAP
VRVSALTAAARADLYGDAFNEEVFMRPGAQLTNAVVAVDDAGVDGSVNALATLVSQTSNR
LRQMQTGFARNYALSMLVGAVLVAAALLVVQLW